^^@^^A^^B^^C^^D^^E^^F^^G^^H^^I^^J^^K^^L^^M^^N^^O^^P^^Q^^R^^S^^T^^U^^V^^W^^X^^Y^^Z^^[^^\^^]^^^^^_ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ÇüéâäàåçêëèïîìÄÅÉæÆôöòûùÿÖÜ¢£¥₧ƒáíóúñѪº¿⌐¬½¼¡«»░▒▓│┤╡╢╖╕╣║╗╝╜╛┐└┴┬├─┼╞╟╚╔╩╦╠═╬╧╨╤╥╙╘╒╓╫╪┘┌█▄▌▐▀αßΓπΣσµτΦΘΩδ∞φε∩≡±≥≤⌠⌡÷≈°∙·√ⁿ²■ buffer sizepool sizenumber of strings???m2d5c2l5x2v5iEnd of file on the terminal!! (That makes 100 errors; please try again.)? You want to edit file at line Type <return> to proceed, S to scroll future error messages,R to run without stopping, Q to run quietly,I to insert something, E to edit your file,1 or ... or 9 to ignore the next 1 to 9 tokens of input,H for help, X to quit.OK, entering batchmodenonstopmodescrollmode...insert>I have just deleted some text, as you asked.You can now delete more, or insert, or whatever.Sorry, I don't know how to help in this situation.Maybe you should try asking a human?Sorry, I already gave what help I could...An error might have occurred before I noticed any problems.``If all else fails, read the instructions.'' (Emergency stopTeX capacity exceeded, sorry [If you really absolutely need more capacity,you can ask a wizard to enlarge me.This can't happen (I'm broken. Please show this to someone who can fix can fixI can't go on meeting you like thisOne of your faux pas seems to have wounded me deeply...in fact, I'm barely conscious. Please fix it and try again.InterruptionYou rang?Try to insert some instructions for me (e.g.,`I\showlists'),unless you just want to quit by typing `X'.main memory sizeAVAIL list clobbered at Double-AVAIL list clobbered at Doubly free location at Bad flag at New busy locs:LINK(INFO([]CLOBBERED.foulfil plus minus []Bad link, display aborted.etc.Unknown node type!unsetbox()x, shifted columns), stretch , shrink , glue set - ?.?< -rule(insert, natural size ; split(); float cost gluenonscriptmskipmuleaders kern (for accent)mkernmathonoff, surrounded (ligature penalty discretionary replacing markvadjustflushingcopyingverticalhorizontaldisplay mathnointernal verticalrestricted horizontal modesemantic nest size### entered at line (hyphenmin (\output routine)### recent contributions:prevdepth ignored, prevgraf linespacefactor , current language this will be denominator of:lineskipbaselineskipparskipabovedisplayskipbelowdisplayskipabovedisplayshortskipbelowdisplayshortskipleftskiprightskiptopskipsplittopskiptabskipspaceskipxspaceskipparfillskipthinmuskipmedmuskipthickmuskip[unknown glue parameter!]skipmuskipptoutputeverypareverymatheverydisplayeveryhboxeveryvboxeveryjobeverycrerrhelptoksparshapeboxvoidcurrent fonttextfontscriptfontscriptscriptfontcatcodelccodeuccodesfcodemathcodepretolerancetolerancelinepenaltyhyphenpenaltyexhyphenpenaltyclubpenaltywidowpenaltydisplaywidowpenaltybrokenpenaltybinoppenaltyrelpenaltypredisplaypenaltypostdisplaypenaltyinterlinepenaltydoublehyphendemeritsfinalhyphendemeritsadjdemeritsmagdelimiterfactorloosenesstimedaymonthyearshowboxbreadthshowboxdepthhbadnessvbadnesspausingtracingonlinetracingmacrostracingstatstracingparagraphstracingpagestracingoutputtracinglostcharstracingcommandstracingrestoresuchyphoutputpenaltymaxdeadcycleshangafterfloatingpenaltyglobaldefsfamescapechardefaulthyphenchardefaultskewcharendlinecharnewlinecharlanguagelefthyphenminrighthyphenminholdinginsertserrorcontextlines[unknown integer parameter!]countdelcodeparindentmathsurroundlineskiplimithsizevsizemaxdepthsplitmaxdepthboxmaxdepthhfuzzvfuzzdelimitershortfallnulldelimiterspacescriptspacepredisplaysizedisplaywidthdisplayindentoverfullrulehangindenthoffsetvoffsetemergencystretch[unknown dimen parameter!]dimenEQUIV(notexpanded:hash sizecsnameendcsnameIMPOSSIBLE.NONEXISTENT.accentadvanceafterassignmentaftergroupbegingroupchardelimiterdivideendgroupexpandafterfontfontdimenhalignhruleignorespacesmathaccentmathcharmathchoicemultiplynoalignnoboundarynoexpandomitpenaltyprevgrafradicalreadrelaxsetboxthevalignvcentervrulesave sizegrouping levelscurlevelretainingrestoringSAVE(Incompatible magnification (); the previous value will be retainedI can handle only one magnification ratio per job. So I'vereverted to the magnification you used earlier on this run.Illegal magnification has been changed to 1000The magnification ratio must be between 1 and 32768.ETC.BAD.->begin-group character end-group character math shift character macro parameter character superscript character subscript character end of alignment templateblank space the letter the character [unknown command code!]: Runaway definitionargumentpreambletext<*><insert> <read l.<argument> <template> <recently read> <to be read again> <inserted text> <output> <everypar> <everymath> <everydisplay> <everyhbox> <everyvbox> <everyjob> <everycr> <mark> <write> input stack sizewrite(interwoven alignment preambles are not allowed)text input levelsparIncomplete ; all text was ignored after line A forbidden control sequence occurred in skipped text.This kind of error happens when you say `\if...' and forgetthe matching `\fi'. I've inserted a `\fi'; this might work.The file ended while I was skipping conditional text.File endedForbidden control sequence found while scanning of I suspect you have forgotten a `}', causing meto read past where you wanted me to stop.I'll try to recover; but if the error is serious,you'd better type `E' or `X' now and fix your file.useText line contains an invalid characterA funny symbol that I can't read has just been input.Continue, and I'll forget that it ever happened.(Please type a command or say `\end')*** (job aborted, no legal \end found)=>Undefined control sequenceThe control sequence at the end of the top lineof your error message was never \def'ed. If you havemisspelled it (e.g., `\hobx'), type `I' and the correctspelling (e.g., `I\hbox'). Otherwise just continue,and I'll forget about whatever was undefined.Missing insertedThe control sequence marked <to be read again> shouldnot appear between \csname and \endcsname.inputendinputtopmarkfirstmarkbotmarksplitfirstmarksplitbotmarkparameter stack sizeArgument of has an extra }I've run across a `}' that doesn't seem to match anything.For example, `\def\a#1{...}' and `\a}' would producethis error. If you simply proceed now, the `\par' thatI've just inserted will cause me to report a runawayargument that might be the root of the problem. But ifyour `}' was spurious, just type `2' and it will go away.Paragraph ended before was completeI suspect you've forgotten a `}', causing me to apply thiscontrol sequence to too much text. How can we recover?My plan is to forget the whole thing and hope for the best.Use of doesn't match its definitionIf you say, e.g., `\def\a1{...}', then you must alwaysput `1' after `\a', since control sequence names aremade up of letters only. The macro here has not beenfollowed by the required stuff, so I'm ignoring it.<-Missing { insertedA left brace was mandatory here, so I've put one in.You might want to delete and/or insert some correctionsso that I will find a matching right brace soon.(If you're confused by all this, try typing `I}' now.)Incompatible glue unitsI'm going to assume that 1mu=1pt when they're mixed.Missing number, treated as zeroA number should have been here; I inserted `0'.(If you can't figure out why I needed to see a number,look up `weird error' in the index to The TeXbook.)spacefactorprevdepthdeadcyclesinsertpenaltieswdhtdplastpenaltylastkernlastskipinputlinenobadnessImproper You can refer to \spacefactor only in horizontal mode;you can refer to \prevdepth only in vertical mode; andneither of these is meaningful inside \write. SoI'm forgetting what you said and using zero instead.You can't use `' after Bad register codeA register number must be between 0 and 255.I changed this one to zero.Bad character codeA character number must be between 0 and 255.Bad numberSince I expected to read a number between 0 and 15,Bad mathcharA mathchar number must be between 0 and 32767.Bad delimiter codeA numeric delimiter code must be between 0 and 2^{27}-1.Improper alphabetic constantA one-character control sequence belongs after a ` mark.So I'm essentially inserting \0 here.Number too bigI can only go up to 2147483647='17777777777="7FFFFFFF,so I'm using that number instead of yours.trueIllegal unit of measure (replaced by filll)I dddon't go any higher than filll.emexmu inserted)The unit of measurement in math glue must be mu.To recover gracefully from this error, it's best todelete the erroneous units; e.g., type `2' to deletetwo letters. (See Chapter 27 of The TeXbook.)inpccmmmbpddccsppt inserted)Dimensions can be in units of em, ex, in, pt, pc,cm, mm, dd, cc, bp, or sp; but yours is a new one!I'll assume that you meant to say pt, for printer's points.Dimension too largeI can't work with sizes bigger than about 19 feet.Continue and I'll use the largest value I can.plusminuswidthheightdepthnumberromannumeralstringmeaningfontnamejobname at Where was the left brace? You said something like `\def\a}',which I'm going to interpret as `\def\a{}'.You already have nine parametersI'm going to ignore the # sign you just used.Parameters must be numbered consecutivelyI've inserted the digit you should have used after the #.Type `1' to delete what you did use.Illegal parameter number in definition of You meant to type ## instead of #, right?Or maybe a } was forgotten somewhere earlier, and thingsare all screwed up? I'm going to assume that you meant ##.*** (cannot \read from terminal in nonstop modes)File ended within This \read has unbalanced braces.ififcatifnumifdimifoddifvmodeifhmodeifmmodeifinnerifvoidifhboxifvboxifxifeofiftrueiffalseifcasefiorelseExtra I'm ignoring this; it doesn't match any \if.{true}{false}Missing = inserted for I was expecting to see `<', `=', or `>'. Didn't.{case .fmtinput file nameI can't find file `I can't write on file `'..texPlease type another *** (job aborted, file error in nonstop mode)texputTeX logtranscript file name.log nullfontFont scaled not loadable: Bad metric (TFM) file not loadable: Metric (TFM) file not foundI wasn't able to read the size data for this font,so I will ignore the font specification.[Wizards can fix TFM files using TFtoPL/PLtoTF.]You might try inserting a different font spec;e.g., type `I\font<same font id>=<substitute font name>'. not loaded: Not enough room leftI'm afraid I won't be able to make use of this font,because my memory for character-size data is too small.If you're really stuck, ask a wizard to enlarge me.Or maybe try `I\font<same font id>=<name of loaded font>'.Missing font identifierI was looking for a control sequence whosecurrent meaning has been defined by \font. has only fontdimen parametersTo increase the number of font parameters, you mustuse \fontdimen immediately after the \font is loaded.font memoryMissing character: There is no in font TeX output vlistoutCompleted box being shipped outMemory usage before: after: ; still untouched: Huge page cannot be shipped outThe page just created is more than 18 feet tall ormore than 18 feet wide, so I suspect something went wrong.The following box has been deleted:No pages of output.Output written on page, bytes).tospreadUnderfullLoose \hbox (badness ) has occurred while \output is active) in paragraph at lines ) in alignment at lines --) detected at line Overfull \hbox (pt too wideTight \hbox (badness vpack \vbox (badness Overfull \vbox (pt too highTight \vbox (badness {}displaystyletextstylescriptstylescriptscriptstyleUnknown style!mathordmathopmathbinmathrelmathopenmathclosemathpunctmathinneroverlineunderlineleftrightlimitsnolimitsfraction, thickness = default, left-delimiter , right-delimiter is undefined (character Somewhere in the math formula just ended, you used thestated character from an undefined font family. For example,plain TeX doesn't allow \it or \sl in subscripts. Proceed,and I'll try to forget that I needed that character.mlist1mlist2mlist30234000122*4000133**3**344*0400400*000000234000111*1111112341011mlist4 inside $$'sDisplays can use special alignments (like \eqalignno)only if nothing but the alignment itself is between $$'s.So I've deleted the formulas that preceded this alignment.spancrcrcrendtemplatealignment tab character Missing # inserted in alignment preambleThere should be exactly one # between &'s, when an\halign or \valign is being set up. In this case you hadnone, so I've put one in; maybe that will work.Only one # is allowed per tabmore than one, so I'm ignoring all but the first.endvExtra alignment tab has been changed to You have given more \span or & marks than there werein the preamble to the \halign or \valign now in progress.So I'll assume that you meant to type \cr instead.256 spansalign1align0Infinite glue shrinkage found in a paragraphThe paragraph just ended includes some glue that hasinfinite shrinkability, e.g., `\hskip 0pt minus 1fil'.Such glue doesn't belong there---it allows a paragraphof any length to fit on one line. But it's safe to proceed,since the offensive shrinkability has been made finite.disc1disc2@@: line t= -> @@ via @@ b= p= d=@firstpass@secondpass@emergencypassparagraphdisc3disc4line breakingHYPH(hyphenation will be flushedHyphenation exceptions must contain only lettersand hyphens. But continue; I'll forgive and forget.Not a letterLetters in \hyphenation words must have \lccode>0.Proceed; I'll ignore the character I just read.exception dictionarypattern memory opspattern memory ops per languagepattern memoryToo late for patternsAll patterns must be given before typesetting begins.Bad (See Appendix H.)NonletterDuplicate patternpruningvertbreakInfinite glue shrinkage found in box being splitThe box you are \vsplitting contains some infinitelyshrinkable glue, e.g., `\vss' or `\vskip 0pt minus 1fil'.Such glue doesn't belong there; but you can safely proceed,vsplit needs a vboxThe box you are trying to split is an \hbox.I can't split such a box, so I'll leave it alone.pagegoalpagetotalpagestretchpagefilstretchpagefillstretchpagefilllstretchpageshrinkpagedepthfillfilll### current page: (held over for next output)total height goal height adds , # might split%% goal height=, max depth=Insertions can only be added to a vboxTut tut: You're trying to \insert into a\box register that now contains an \hbox.Proceed, and I'll discard its present contents.pageInfinite glue shrinkage found on current pageThe page about to be output contains some infinitely g= c=Infinite glue shrinkage inserted from The correction glue for page breaking with insertionsmust have finite shrinkability. But you may proceed,% split to 255 is not voidYou shouldn't use \box255 except in \output routines.Output loop--- consecutive dead cyclesI've concluded that your \output is awry; it never does a\shipout, so I'm shipping \box255 out myself. Next timeincrease \maxdeadcycles if you want me to be more patient!Unbalanced output routineYour sneaky output routine has problematic {'s and/or }'s.I can't handle that very well; good luck.Output routine didn't use all of Your \output commands should empty \box255,e.g., by saying `\shipout\box255'.Proceed; I'll discard its present contents.Missing $ insertedI've inserted a begin-math/end-math symbol since I thinkyou left one out. Proceed, with fingers crossed.' in Sorry, but I'm not programmed to handle this case;I'll just pretend that you didn't ask for it.If you're in the wrong mode, you might be able toreturn to the right one by typing `I}' or `I$' or `I\par'.enddumphskiphfilhfillhsshfilnegvskipvfilvfillvssvfilnegI've inserted something that you may have forgotten.(See the <inserted text> above.)With luck, this will get me unwedged. But if youreally didn't forget anything, try typing `2' now; thenmy insertion and my current dilemma will both disappear.right.Things are pretty mixed up, but I think the worst is over.Too many }'sYou've closed more groups than you opened.Such booboos are generally harmless, so keep going.rightbraceExtra }, or forgotten I've deleted a group-closing symbol because it seems to bespurious, as in `$x}$'. But perhaps the } is legitimate andyou forgot something else, as in `\hbox{$x}'. In such casesthe way to recover is to insert both the forgotten and thedeleted material, e.g., by typing `I$}'.moveleftmoverightraiselowercopylastboxvtophboxshipoutleaderscleadersxleadersLeaders not followed by proper glueYou should say `\leaders <box or rule><hskip or vskip>'.I found the <box or rule>, but there's no suitable<hskip or vskip>, so I'm ignoring these leaders.Sorry; this \lastbox will be void.Sorry...I usually can't take things from the current page.This \lastbox will therefore be void.Missing `to' insertedI'm working on `\vsplit<box number> to <dimen>';will look for the <dimen> next.A <box> was supposed to be hereI was expecting to see \hbox or \vbox or \copy or \box orsomething like that. So you might find something missing inyour output. But keep trying; you can fix this later.indentnoindent' here except with leadersTo put a horizontal rule in an hbox or an alignment,you should use \leaders or \hrulefill (see The TeXbook).You can't I'm changing to \insert0; box 255 is special.Try `I\vskip-\lastskip' instead.Try `I\kern-\lastkern' instead.Perhaps you can make the output routine do it.unpenaltyunkernunskipunhboxunhcopyunvboxunvcopyIncompatible list can't be unboxedSorry, Pandora. (You sneaky devil.)I refuse to unbox an \hbox in vertical mode or vice versa.And I can't open any boxes in math mode.Illegal math Sorry: The third part of a discretionary break must beempty, in math formulas. I had to delete your third part.Discretionary list is too longWow---I never thought anybody would tweak me here.You can't seriously need such a huge discretionary list?Improper discretionary listDiscretionary lists must contain only boxes and kerns.The following discretionary sublist has been deleted:Missing } insertedI've put in what seems to be necessary to fixthe current column of the current alignment.Try to go on, since this might almost work.Misplaced I can't figure out why you would want to use a tab markhere. If you just want an ampersand, the remedy issimple: Just type `I\&' now. But if some right braceup above has ended a previous alignment prematurely,you're probably due for more error messages, and youmight try typing `S' now just to see what is salvageable.or \cr or \span just now. If something like a right braceI expect to see \noalign only after the \cr ofan alignment. Proceed, and I'll ignore this case.I expect to see \omit only after tab marks or the \cr ofI'm guessing that you meant to end an alignment here.I'm ignoring this, since I wasn't doing a \csname.eqnoleqnodisplaylimitsLimit controls must follow a math operatorI'm ignoring this misplaced \limits or \nolimits command.Missing delimiter (. inserted)I was expecting to see something like `(' or `\{' or`\}' here. If you typed, e.g., `{' instead of `\{', youshould probably delete the `{' by typing `1' now, so thatbraces don't get unbalanced. Otherwise just proceed.Acceptable delimiters are characters whose \delcode isnonnegative, or you can use `\delimiter <delimiter code>'.Please use for accents in math modeI'm changing \accent to \mathaccent here; wish me luck.(Accents are not the same in formulas as they are in text.)Double superscriptI treat `x^1^2' essentially like `x^1{}^2'.Double subscriptI treat `x_1_2' essentially like `x_1{}_2'.aboveoveratopabovewithdelimsoverwithdelimsatopwithdelimsAmbiguous; you need another { and }I'm ignoring this fraction specification, since I don'tknow whether a construction like `x \over y \over z'means `{x \over y} \over z' or `x \over {y \over z}'.I'm ignoring a \right that had no matching \left.Math formula deleted: Insufficient symbol fontsSorry, but I can't typeset math unless \textfont 2and \scriptfont 2 and \scriptscriptfont 2 have allthe \fontdimen values needed in math symbol fonts.Math formula deleted: Insufficient extension fontsSorry, but I can't typeset math unless \textfont 3and \scriptfont 3 and \scriptscriptfont 3 have allthe \fontdimen values needed in math extension fonts.Display math should end with $$The `$' that I just saw supposedly matches a previous `$$'.So I shall assume that you typed `$$' both times.displayMissing $$ insertedlongouterglobaldefgdefedefxdefprefixYou can't use a prefix with `I'll pretend you didn't say \long or \outer or \global.' or `' with `I'll pretend you didn't say \long or \outer here.Missing control sequence insertedPlease don't say `\def cs{...}', say `\def\cs{...}'.I've inserted an inaccessible control sequence so that yourdefinition will be completed without mixing me up too badly.You can recover graciously from this error, if you'recareful; see exercise 27.2 in The TeXbook.inaccessibleletfutureletchardefmathchardefcountdefdimendefskipdefmuskipdeftoksdefYou should have said `\read<number> to \cs'.I'm going to look for the \cs now.Invalid code (), should be in the range 0..), should be at most I'm going to use 0 instead of that illegal code value.byArithmetic overflowI can't carry out that multiplication or division,since the result is out of range.I'm forgetting what you said and not changing anything.Sorry, \setbox is not allowed after \halign in a display,or between \accent and an accented character.Bad space factorI allow only values in the range 1..32767 here.I allow only nonnegative values here.Patterns can be loaded only by INITEXhyphencharskewcharFONTatscaledImproper `at' size (pt), replaced by 10ptI can only handle fonts at positive sizes that areless than 2048pt, so I've changed what you said to 10pt.select font errorstopmodeopenincloseinmessageerrmessage(That was another \errmessage.)This error message was generated by an \errmessagecommand, so I can't give any explicit help.Pretend that you're Hercule Poirot: Examine all clues,and deduce the truth by order and method.lowercaseuppercaseshowshowboxshowtheshowlistsThis isn't an error message; I'm just \showing something.Type `I\show...' to show more (e.g., \show\cs,\showthe\count10, \showbox255, \showlists).And type `I\tracingonline=1\show...' to show boxes andlists on your terminal as well as in the transcript file.> undefinedmacrolong macroouter macroouter endtemplate> \boxOK (see the transcript file) (INITEX)You can't dump inside a group`{...\dump}' is a no-no. strings of total length memory locations dumped; current usage is multiletter control sequences words of font info for preloaded font\font hyphenation exceptionHyphenation trie of length has op out of for language (preloaded format=Beginning to dump on file TeX-format )end occurred inside a group at level when on line was incomplete)(see the transcript file for additional information)(\dump is performed only by INITEX)debug # (-1 to exit):openoutcloseoutspecialimmediatesetlanguage[unknown extension!]ext1whatsit?ext2ext3endwriteUnbalanced write commandOn this page there's a \write with fewer real {'s than }'s.ext4output file nametexdump.tex (preloaded format=texdump.tex 92.4.8)plainactivedospecialsdo@netw@thr@@sixt@@n@cclv@cclvi@m@M@MMinsc@untallocationnumberm@newlogcount@dimen@dimen@idimen@iiskip@toks@newcountalloc@newdimennewskipnewmuskipnewboxnewtoksnewhelpnewreadnewwritenewfamnewlanguagech@cknewinsertmaxdimenhideskipcenteringp@z@z@skipvoidb@xnewif@ifif@smallskipamountmedskipamountbigskipamountnormalbaselineskipnormallineskipnormallineskiplimitjotinterdisplaylinepenaltyinterfootnotelinepenaltymagstephalfmagsteptenrmcmr10sevenrmcmr7fivermcmr5tenicmmi10sevenicmmi7fiveicmmi5tensycmsy10sevensycmsy7fivesycmsy5tenexcmex10tenbfcmbx10sevenbfcmbx7fivebfcmbx5tenttcmtt10tenslcmsl10tenitcmti10preloadedundefinedrmmitoldstylecalitfamitslfamslbffambfttfamttfrenchspacingnonfrenchspacingnormalbaselineslqrqlbrackrbrackendgrafendlinespaceemptynullbgroupegroupobeylinesobeyspaceslooprepeatbodyiteratenextthinspacenegthinspaceenspaceenskipquadqquadsmallskipmedskipbigskipnointerlineskipoffinterlineskiptopgluevgluevgl@nobreakhgluehgl@leavevmodeslashbreakallowbreakfilbreakgoodbreakejectsuperejectremovelastskipsmallbreakmedbreakbigbreaklineleftlinerightlinecenterlinerlapllapm@thunderbarstrutboxstruthidewidthialignmscountmultispansp@nifus@us@trueus@falseif@cr@crtrue@crfalsetabstabsyettabsdonecleartabssettabssett@bs@tt@bs@tcolsm@ketabboxtabaligncolumns@nothert@bboxt@bb@xhangtextindentitemitemitemnarrowerbeginsectionproclaimraggedrightttraggedrightssaeoeAEOEaaAAmathhexboxdagddagoalignooalignsh@ftcopyrightdotsldotsTeXhrulefilldotfillrightarrowfillrightarrowleftarrowfillleftarrowbraceldbracerdbracelubracerudownbracefillupbracefillbyespsbprim@sprimepr@m@snxtpr@@@spr@@@tnotalphabetagammadeltaepsilonzetaetathetaiotakappalambdamunuxipirhosigmatauupsilonphichipsiomegavarepsilonvarthetavarpivarrhovarsigmavarphiGammaDeltaThetaLambdaXiPiSigmaUpsilonPhiPsiOmegaalephhbarimathjmathellwpReImpartialinftyemptysetnablasurdtopbotangletriangleforallexistsneglnotflatnaturalsharpclubsuitdiamondsuitheartsuitspadesuitcoprodbigveebigwedgebiguplusbigcapbigcupintopintprodsumbigotimesbigoplusbigodotointopointbigsqcupsmallinttrianglelefttrianglerightbigtriangleupbigtriangledownwedgelandveelorcapcupddaggerdaggersqcapsqcupuplusamalgdiamondbulletwrdivodotoslashotimesominusoplusmppmcircbigcircsetminuscdotasttimesstarproptosqsubseteqsqsupseteqparallelmiddashvvdashnearrowsearrownwarrowswarrowLeftrightarrowLeftarrowRightarrowneqneleqlegeqgesuccprecapproxsucceqpreceqsupsetsubsetsupseteqsubseteqinniownsggllleftrightarrowgetstomapstocharmapstosimsimeqperpequivasympsmilefrownleftharpoonupleftharpoondownrightharpoonuprightharpoondownjoinrelrelbarsmashRelbarlhookhookrightarrowrhookhookleftarrowbowtiemodelsLongrightarrowlongrightarrowlongleftarrowLongleftarrowlongmapstolongleftrightarrowLongleftrightarrowiffldotpcdotpcoloncdotsvdotsddotsacutegraveddottildebarbrevecheckhatvecdotwidetildewidehatoverrightarrowoverleftarrowoverbraceunderbraceskewlmoustachermoustachelgrouprgrouparrowvertArrowvertbracevertVertvertuparrowdownarrowupdownarrowUparrowDownarrowUpdownarrowbackslashranglelanglerbracelbracerceillceilrfloorlfloorbiglbigbigmbigrBiglBigBigmBigrbigglbiggbiggmbiggrBigglBiggBiggmBiggrn@spacechoosebrackbracesqrtmathpaletterootboxrootofr@@tifv@v@truev@falseifh@h@trueh@falsevphantomph@nthphantomphantommathph@ntmakeph@ntfinph@ntmathstrutmathsm@shmakesm@shfinsm@shcong@vereqnotinc@ncelrightleftharpoonsrlh@buildreldoteqloglglnlimlimsupliminfsinarcsinsinhcosarccoscoshtanarctantanhcotcothseccscmaxminsupinfargkerdimhomdetexpPrgcddegbmodpmodcasesmatrixpmatrixp@renwdbordermatrixopenup@penupeqalignifdt@pdt@ptruedt@pfalsedispl@y@ligndisplaylineseqalignnoleqalignnopagenoheadlinefootlinefolioifr@ggedbottomr@ggedbottomtruer@ggedbottomfalseraggedbottomnormalbottomnopagenumbersadvancepagenofootinsfootnote@sfvfootnotefootstrutfo@tf@@tf@t@foottopinsifp@gep@getruep@gefalseif@mid@midtrue@midfalsetopinsert@insmidinsertpageinsertendinsertplainoutputmakeheadlinepagebodymakefootlinedosuperejectpagecontentsfootnoterulehyphenassociate associates declination obligatory philanthropic present presents project projects reciprocity recognizance reformation retribution table magnificationm@gtracingallshowhyphensfmtnamefmtversion (preloaded format=plain 93.10.14)MTams.iniamstexplainfmtversionamstexloaded@W@CR@toks@@rightappend@alloclist@ifalloc@alloc@truealloc@falseshowallocationsnext@count@@count@@@FN@DN@DNii@nextii@RIfM@RIfMIfI@setboxz@hwdz@boxz@setbox@newd@neerr@defaulthelp@Sorry, I already gave what help I could...
Maybe you should try asking a human?
An error might have occurred before I noticed any problems.
``If all else fails, read the instructions.''Err@eat@in@in@@in@falsein@trueifin@space@athelp@Only certain combinations beginning with @ make sense to me.
Perhaps you wanted \@ for a printed @?
I've ignored the character or group after @.at@at@@at@@@Invalid@@atdef@defahelp@definecsIf you typed \define cs instead of \define\cs
I've substituted an inaccessible control sequence so that your
definition will be completed without mixing me up too badly.
If you typed \define{\cs} the inaccessible control sequence
was defined to be \cs, and the rest of your
definition appears as input.defbhelp@I've ignored your definition, because it might
conflict with other uses that are important to me.define@define@@undefined@@@@@@@@@@preloaded@@@@@@@@@@next@@@@@@@@@@redefinepredefineundefinecaptionwidth@pagewidthpageheighthcorrectionvcorrectiontiegraveaccentacuteaccenttildeaccenthataccentunderscoreic@textfonti @; @: @?relaxnext@ @-srdr@drsr@sldl@dlsl@ @"nextiii@nextiv@flushpartextfontiilbrace@rbrace@AmSTeXvmodeerr@mathmodeerr@linebreaksaveskip@allowlinebreaknolinebreaknewlinedmatherr@nondmatherr@onlydmatherr@nonmatherr@mathbreaknomathbreakallowmathbreakpagebreaknopagebreaknonvmodeerr@vnonvmode@newpagesmallpagebreakmedpagebreakbigpagebreakNoBlackBoxesBlackBoxesInvalid@captioncaptionwidthsmallcaptionwidth@topspacemid@falseins@midspacemid@trueifmid@captionfont@thespace@nextv@nextvi@thecaption@nextvii@newcodes@oldcodes@commentcomment@comment@@comment@@@prime@dsizetsizessizesssizemedspacenegmedspacethickspacenegthickspace @, @! @.andDOTSBimpliesimpliedbyfracdfractfracex@thicknessthickfracfracwithdelimsthickfracwithdelimsldelim@rdelim@binomdbinomtbinomsnugtopsmashtop@truebot@falsesmash@botsmashtop@falsebot@trueiftop@ifbot@LimitsOnSumsslimits@NoLimitsOnSumscoprod@bigvee@bigwedge@biguplus@bigcap@bigcup@prod@sum@bigotimes@bigoplus@bigodot@bigsqcup@LimitsOnIntsilimits@NoLimitsOnIntsDOTSIintic@negintic@intkern@intdots@plaincdots@intno@iintints@iiintiiiintidotsintfindlimits@ints@@iflimtoken@limtoken@truelimtoken@falseiflimits@limits@truelimits@falsemultint@multintlimits@ints@@@LimitsOnNamesnlimits@NoLimitsOnNamesnolimits@newmcodes@operatornameoperatornamewithlimitsqopname@qopnamewl@injlimprojlimvarinjlimvarprojlimvarliminfvarlimsupbuffer@bufferChangeBufferResetBuffershavetopshavebotshaveLet@vspacevspace@multilimits@SbendSbSpendSpspreadlinesMathstrut@Mathstrutbox@spreadmlines@spreadmatrixlinesendmatrixformatformat@hashtoks@preamble@preamble@@smallmatrixendsmallmatrixendpmatrixbmatrixendbmatrixvmatrixendvmatrixVmatrixendVmatrixhdotsdotsspace@strip@spacehdotsforhdotsformultispan@spaceinnerhdotsafterinnerhdotsforendcasesifinany@inany@trueinany@falseifinalign@inalign@trueinalign@falseifingather@ingather@trueingather@falsestrut@strutbox@topalignedaligned@botalignedalignedendalignedendtopalignedendbotalignedalignedatdoat@atcount@endalignedatgatheredendgatherediftagsleft@tagsleft@truetagsleft@falseTagsOnLeftTagsOnRightifmathtags@mathtags@truemathtags@falseTagsAsMathTagsAsTexttagform@thetagtagmaketag@maketag@@maketag@@@maketag@@@@allowdisplaybreaksallowdisplaybreakdisplaybreakintertextallowdisplaybreak@displaybreak@intertext@centering@aligngatheralign@andhelp@An extra & here is so disastrous that you should probably exit